The domain within your query sequence starts at position 586 and ends at position 753; the E-value for the Ceramidse_alk_C domain shown below is 8e-50.

FRDLAKAIATDTVANMSSGPEPPFFKNLIASLIPNIADRAPIGKHFGDVLQPAKPEYRVG
EVVEVIFVGANPKNSAENQTHQTFLTVEKYEDSVADWQIMYNDASWETRFYWHKGILGLS
NATIYWHIPDTAYPGIYRIRYFGHNRKQELLKPAVILAFEGISSPFEV

Ceramidse_alk_C

Ceramidse_alk_C
PFAM accession number:PF17048
Interpro abstract (IPR031331): This family represents the C-terminal domain of a group of neutral/alkaline ceramidases found in both bacteria and eukaryotes [(PUBMED:10753931), (PUBMED:10781606), (PUBMED:10593963)]. The EC classification is (EC 3.5.1.23). The enzyme hydrolyses ceramide to generate sphingosine and fatty acid. The enzyme plays a regulatory role in a variety of physiological events in eukaryotes and also functions as an exotoxin in particular bacteria. This C-terminal tail of the enzyme is highly conserved across all species and may play a role in the interaction of the enzyme with the plasma membranes. The tail is also vital for the stabilisation of the enzyme as a whole [(PUBMED:19088069)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ceramidse_alk_C