The domain within your query sequence starts at position 1 and ends at position 174; the E-value for the ChaC domain shown below is 5.9e-71.
MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPGGSV WGVAYKLPVGKEEEVKTYLDFREKGGYRTTTVIFYPKDSTTKPFSVLLYIGTCDNPNYLG PAPLEDIAEQIFNAAGPSGRNTEYLFELADSVRKLVPEDADEHLFSLEKLVKER
ChaC |
---|
PFAM accession number: | PF04752 |
---|---|
Interpro abstract (IPR006840): | The ChaC family of proteins function as gamma-glutamyl cyclotransferases acting specifically to degrade glutathione but not other gamma-glutamyl peptides [ (PUBMED:23070364) (PUBMED:25716890) ]. It is is conversed across all phyla and represents a new pathway for glutathione degradation in living cells. |
GO process: | glutathione catabolic process (GO:0006751) |
GO function: | gamma-glutamylcyclotransferase activity (GO:0003839) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ChaC