The domain within your query sequence starts at position 40 and ends at position 176; the E-value for the Chibby domain shown below is 1e-13.

LPRMSRRVASQHSYPLNRFSSMPFDPMERPTSQADLELDYNPPRVQLSDEMFVFQDGRWV
NESCRLQPPYFSPPSSFHHKLHHRRLAKEYQLQEENKSLRDENRALRDENKALRKENKIL
QVFWEEHKVTLGHEESQ

Chibby

Chibby
PFAM accession number:PF14645
Interpro abstract (IPR028118):

This family from eukaryotes includes the chibby proteins and spermatid-associated protein (Spert). Chibby proteins inhibit the wingless/Wnt pathway by binding to beta-catenin and inhibiting beta-catenin-mediated transcriptional activation. Chibby is Japanese for small, and is named after the RNAi phenotype seen in Drosophila [ (PUBMED:12712206) ]. Spermatid-associated protein is expressed in the flower-like structure in spermatids and its function is unclear [ (PUBMED:12204287) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Chibby