The domain within your query sequence starts at position 92 and ends at position 263; the E-value for the Chlorophyllase2 domain shown below is 4.4e-9.

PFKAKESGYPLIILSHGLGGFRASYSAFCMELASRGFVVAAVEHRDQSAAATYFCKPTSQ
ESSPAESLEEEWLPFRRIKEGEKEFHVRNPQVHQRVKECVRVLRILQDASAGKTVVNVFP
GGLDLMTLKGSIDRNRVAVMGHSFGGATAVLALTQEVQFRCAIALDAWMFPL

Chlorophyllase2

Chlorophyllase2
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Chlorophyllase2