The domain within your query sequence starts at position 290 and ends at position 500; the E-value for the Choline_transpo domain shown below is 4.9e-69.

IYAISATVFTVILFLIMLVMRKRVALTIALFHVAGKVFIHLPLLVFQPFWTFFALVLFWA
YWIMTLLFLGTTGSAVQNEQGFVEYKISGPLQYMWWYHVVGLIWISEFILACQQMTVAGA
VVTYYFTRDKRNLPFTPILASVNRLIRYHLGTVAKGSFIITLVKIPRMVLMYIHSQLKGK
ENACARCMLKSCICCLWCLEKCLSYLNQVCM

Choline_transpo

Choline_transpo
PFAM accession number:PF04515
Interpro abstract (IPR007603):

This entry represents a family of proteins probably involved in transport through the plasma membrane [(PUBMED:15002745)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Choline_transpo