The domain within your query sequence starts at position 2 and ends at position 118; the E-value for the Chorein_N domain shown below is 1.8e-37.

LEGLVAWVLNTYLGKYVNNLNTDQLSVALLKGAVELENLPLKKDALKELELPFEVKAGLI
GKVTLQIPFYRPHVDPWVISISGLHVIGGPEKIQDFNDEKEKLLERERKKALLQALE

Chorein_N

Chorein_N
PFAM accession number:PF12624
Interpro abstract (IPR026854):

Although mutations in the full-length vacuolar protein sorting 13A (VPS13A) protein in vertebrates lead to the disease of chorea-acanthocytosis, the exact function of any of the regions within the protein is not yet known. This domain is the proposed leucine zipper at the N terminus of VPS13A and related proteins. The full-length protein is a transmembrane protein with a presumed role in vesicle-mediated sorting and intracellular protein transport [(PUBMED:17196930)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Chorein_N