The domain within your query sequence starts at position 3 and ends at position 117; the E-value for the Chorein_N domain shown below is 5.4e-38.
FESVVVEVLNRFLGDYVVNLDESQLSLGIWKGAVALKNLVIKENALHELDVPFKVKVGHI GSLKLKIPWKNLYTQPVEAVLEEIFLLIVPSSRIQYDPIKEEKQLMETKQQELKR
Chorein_N |
---|
PFAM accession number: | PF12624 |
---|---|
Interpro abstract (IPR026854): | Although mutations in the full-length vacuolar protein sorting 13A (VPS13A) protein in vertebrates lead to the disease of chorea-acanthocytosis, the exact function of any of the regions within the protein is not yet known. This domain is the proposed leucine zipper at the N terminus of VPS13A and related proteins. The full-length protein is a transmembrane protein with a presumed role in vesicle-mediated sorting and intracellular protein transport [ (PUBMED:17196930) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Chorein_N