The domain within your query sequence starts at position 450 and ends at position 501; the E-value for the Chromo_shadow domain shown below is 2.9e-25.
RCNLKMLGSGELMFLMKWKDSDEADLVQAKEANMICPQIVISFYGERLTWHS
Chromo_shadow |
---|
PFAM accession number: | PF01393 |
---|---|
Interpro abstract (IPR008251): | Chromo shadow domain is distantly related to chromo domain. It is always found in association with a chromo domain. The CHROMO (CHRromatin Organization MOdifier) domain [ (PUBMED:1982376) (PUBMED:1708124) (PUBMED:7667093) (PUBMED:7501439) ] is a conserved region of around 60 amino acids, originally identified in Drosophila modifiers of variegation. These are proteins that alter the structure of chromatin to the condensed morphology of heterochromatin, a cytologically visible condition where gene expression is repressed. In one of these proteins, Polycomb, the chromo domain has been shown to be important for chromatin targeting. Proteins that contain a chromo domain appear to fall into 3 classes. The first class includes proteins having an N-terminal chromo domain followed by a region termed the chromo shadow domain [ (PUBMED:7667093) ], eg. Drosophila and human heterochromatin protein Su(var)205 (HP1); and mammalian modifier 1 and modifier 2. The second class includes proteins with a single chromo domain, eg. Drosophila protein Polycomb (Pc); mammalian modifier 3; human Mi-2 autoantigenand and several yeast and Caenorhabditis elegans hypothetical proteins. In the third class paired tandem chromo domains are found, eg. in mammalian DNA-binding/helicase proteins CHD-1 to CHD-4 and yeast protein CHD1. |
GO component: | nucleus (GO:0005634) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Chromo_shadow