The domain within your query sequence starts at position 479 and ends at position 537; the E-value for the Chromosome_seg domain shown below is 8.8e-22.

RLLCYLLHLRFRSSRSGRLSLHGDIRLLFSRRSLELDTGLPYELQAVTEAPHNPRYSPL

Chromosome_seg

Chromosome_seg
PFAM accession number:PF13889
Interpro abstract (IPR033473): This domain can be found in the C terminus of the animal FAM241 proteins and the fission yeast SPAC3H8.04 protein. The function of the FAM241 proteins is not clear. From a high-throughput knockout screen, SPAC3H8.04 was identified as a protein required for meiotic chromosome segregation [(PUBMED:16169489)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Chromosome_seg