The domain within your query sequence starts at position 2 and ends at position 100; the E-value for the Cid2 domain shown below is 4.8e-23.
AAPSGSVNCEEFAEFQLMAAHVSRDRVIKNCIAQTSAVVKSLREEREKNLDDLTLLKRLR KEQTKLKWMQSELNVEEVVNDRSWKVFNERCRVHFKPPK
Cid2 |
---|
PFAM accession number: | PF09774 |
---|---|
Interpro abstract (IPR019171): | This entry represents proteins that mediate the disruption of the DNA replication checkpoint (S-M checkpoint) mechanism caused by caffeine. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cid2