The domain within your query sequence starts at position 45 and ends at position 166; the E-value for the CitMHS domain shown below is 1.1e-15.
AVYWVSEAVPLGAAALVPAFLYPFFGVLRSSEVAAEYFKNTTLLLVGVICVAAAVEKWNL HKRIALRMVLMAGAKPGMLLLCFMCCTTMLSMWLSNTSTTAMVMPIVEAVLQELINAEEE QL
CitMHS |
---|
PFAM accession number: | PF03600 |
---|---|
Interpro abstract (IPR004680): | This domain is found in proteins belonging to the CitM transporter, NhaD Na+/H+ antiporter and Na+/sulfate symporter families, such as CitM from Bacillus subtilis [ (PUBMED:11891560) ], NhaD from Halomonas elongata [ (PUBMED:16872527) ] and SLT1 from Chlamydomonas reinhardtii [ (PUBMED:20498339) ]. |
GO process: | transmembrane transport (GO:0055085) |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CitMHS