The domain within your query sequence starts at position 244 and ends at position 421; the E-value for the Citrate_bind domain shown below is 1.7e-94.
REAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNELAN YGEYSGAPSEQQTYDYAKTILSLMTREKHPEGKILIIGGSIANFTNVAATFKGIVRAIRD YQGPLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALGH
Citrate_bind |
---|
PFAM accession number: | PF16114 |
---|---|
Interpro abstract (IPR032263): | This is a conserved domain containing the citrate-binding sites found in the ATP-citrate synthases (also known as ATP citrate lyases). This domain has a Rossmann fold [ (PUBMED:20558738) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Citrate_bind