The domain within your query sequence starts at position 693 and ends at position 765; the E-value for the Clathrin_bdg domain shown below is 1.1e-36.
ELRGVWTELQDIHDAHGLRYQWGGSHSNKKLLCSLGIDTRNILFTGNKKQPVIVPMYAAG LGMLEPTKEPLKP
Clathrin_bdg |
---|
PFAM accession number: | PF15045 |
---|---|
Interpro abstract (IPR029205): | Aftiphilin forms a stable complex with p200 and gamma-synergin [ (PUBMED:18815278) ]. It may play a role in membrane trafficking. Aftiphilin contains a clathrin box, with two identified clathrin-binding motifs [ (PUBMED:15811338) (PUBMED:15758025) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Clathrin_bdg