The domain within your query sequence starts at position 3 and ends at position 206; the E-value for the Cluap1 domain shown below is 8.7e-93.

RALGYPRHISMENFRTPNFGLVSEVLLWLVKRYEPQTDIPSDIETEQDRVFFIKAIAQFM
ATKAHIKLNTKKLYQADGYAVKELLKITSVLYNAMKTKGMEGSNVGEEDISKFKFDLGSK
IADLKAARQLASEITAKGASLYDLLGKEVELRELRTEAIARPLEINETEKVMRIAIKDLL
AQVQKTKDLLNNVASDEANLEAKI

Cluap1

Cluap1
PFAM accession number:PF10234
Interpro abstract (IPR019366):

This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin. Cluap1 expression is highest in the nucleus and gradually increases during late S to G2/M phases of the cell cycle and returns to the basal level in the G0/G1 phases. In addition, it is upregulated in colon cancer tissues compared to corresponding non-cancerous mucosa. It thus plays a crucial role in the life of the cell [(PUBMED:15480429)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cluap1