The domain within your query sequence starts at position 19 and ends at position 87; the E-value for the Cmc1 domain shown below is 5.6e-22.

IPKIIREKARERCSEQVEDFTRCCKDSGILMVLKCRKENSALKDCLTAYYNDPAFYEECK
LEYLKEREE

Cmc1

Cmc1
PFAM accession number:PF08583
Interpro abstract (IPR013892):

Cmc1 is a metallo-chaperone like protein which is known to localise to the inner mitochondrial membrane in Saccharomyces cerevisiae. It is essential for full expression of cytochrome c oxidase and respiration [(PUBMED:18443040)]. Cmc1 contains two Cx9C motifs and is able to bind copper(I). Cmc1 is thought to play a role in mitochondrial copper trafficking and transfer to cytochrome c oxidase.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cmc1