The domain within your query sequence starts at position 16 and ends at position 71; the E-value for the Cmyb_C domain shown below is 1.9e-23.

FSPSQFLNFWNKQDTLELESPSLTSTPVCSQKVVVTTPLHRDKTPLHQKYPSSVSQ

Cmyb_C

Cmyb_C
PFAM accession number:PF09316
Interpro abstract (IPR015395):

This entry represents the C-terminal domain of the proto-oncogene c-myb and the viral transforming protein myb. Truncation of the domain results in 'activation' of c-myb and subsequent tumourigenesis [ (PUBMED:2670562) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cmyb_C