The domain within your query sequence starts at position 484 and ends at position 590; the E-value for the CoA_binding domain shown below is 3.9e-14.

SRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQKFYWGHKEILIPVF
KNMADAMKKHPEVDVLINFASLRSAYDSTMETMNYAQIRTIAIIAEG

CoA_binding

CoA_binding
PFAM accession number:PF02629
Interpro abstract (IPR003781): This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases.
GO function:cofactor binding (GO:0048037)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CoA_binding