The domain within your query sequence starts at position 21 and ends at position 195; the E-value for the CoaE domain shown below is 3.5e-9.

FFSSVCAKIVQLLGQNEVDYHQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDN
ELIFKTLKEITEGKTVQIPVYDFVSHSRKEETVTIYPADVVLFEGILAFYSQEVRDLFQM
KLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADV

CoaE

 CoaE
PFAM accession number:PF01121
Interpro abstract (IPR001977):

This family contains Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.24 ), which catalyzes the final step in dephosphocoenzyme A (dCoA) biosynthesis, the phosphorylation of the 3'-hydroxyl group of ribose using ATP as a phosphate donor.

The crystal structures of a number of the proteins in this entry have been determined, including the structure of the protein from Haemophilus influenzae to 2.0-A resolution in a comlex with ATP. The protein consists of three domains: the nucleotide-binding domain with a five-stranded parallel beta-sheet, the substrate-binding alpha-helical domain, and the lid domain formed by a pair of alpha-helices; the overall topology of the protein resembles the structures of other nucleotide kinases [ (PUBMED:11886213) ].

GO process:coenzyme A biosynthetic process (GO:0015937)
GO function:dephospho-CoA kinase activity (GO:0004140), ATP binding (GO:0005524)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CoaE