The domain within your query sequence starts at position 148 and ends at position 239; the E-value for the Cobl domain shown below is 5.4e-49.

KKPTPIIPEKTVRVVINFKKTQKTIVRVSPHAPLQDLAPIICSKCEFDPLHTVLLKDYQA
QEPLDLTKSLNDLGLRELYAMDISRESCQISH

Cobl

Cobl
PFAM accession number:PF09469
Interpro abstract (IPR019025):

The Cordon-bleu protein domain is highly conserved among vertebrates. The sequence contains three repeated lysine, arginine, and proline-rich regions, the KKRAP motif. The exact function of the protein is unknown but it is thought to be involved in mid-brain neural tube closure. It is expressed specifically in the node [(PUBMED:14512015)]. This domain has a ubiquitin-like fold.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cobl