The domain within your query sequence starts at position 1 and ends at position 80; the E-value for the Cofilin_ADF domain shown below is 1.7e-23.
MKIDKDERLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSP VGCKPEQQMMYAGSKNKLVQ
Cofilin_ADF |
---|
PFAM accession number: | PF00241 |
---|---|
Interpro abstract (IPR002108): | The actin-depolymerising factor homology (ADF-H) domain is an ~150-amino acid motif that is present in three phylogenetically distinct classes of eukaryotic actin-binding proteins [ (PUBMED:9693358) (PUBMED:12207032) (PUBMED:9047337) ]:
Although these proteins are biochemically distinct and play different roles in actin dynamics, they all appear to use the ADF-H domain for their interactions with actin. The ADF-H domain consists of a six-stranded mixed beta-sheet in which the four central strands (beta2-beta5) are anti-parallel and the two edge strands (beta1 and beta6) run parallel with the neighbouring strands. The sheet is surrounded by two alpha-helices on each side [ (PUBMED:9693358) (PUBMED:12207032) (PUBMED:15522287) ]. |
GO function: | actin binding (GO:0003779) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cofilin_ADF