The domain within your query sequence starts at position 1788 and ends at position 1829; the E-value for the Cohesin_HEAT domain shown below is 1.1e-14.

KCLSEVVAVDPSILARLDMQRGVHGRLMDNSTSVREAAVELL

Cohesin_HEAT

Cohesin_HEAT
PFAM accession number:PF12765
Interpro abstract (IPR026003):

This HEAT repeat is found most frequently in sister chromatid cohesion proteins such as Nipped-B [(PUBMED:15060134)]. HEAT repeats are found tandemly repeated in many proteins, and they appear to serve as flexible scaffolding on which other components can assemble.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cohesin_HEAT