The domain within your query sequence starts at position 29 and ends at position 576; the E-value for the Cohesin_load domain shown below is 8.7e-130.

ESWYLALLGFAEHFRTSSPPKIRLCVHCLQAVFPFKPPQRIEARTHLQLGSVLYHHTKNS
EQARSHLEKAVLASSQIPQFEDVKFEAASLLSELYCQENSVDAAKPLLRKAIQISQQTPY
WHCRLLFQLAQLHTLEKDLVSACDLLGVGAEYARVVGSEYTRALFLLSKGMLLLMERKLQ
EVHPLLTLCGQIVENWQGNPIQKESLRVFFLVLQVTHYLDAGQVKSVKPCLKQLQQCIQT
ISTLHDDEILPSNPADLFHWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLEK
LKMLDCSPILSSFQVILLEHIIMCRLVTGHKATALQEISQVCQLCQQSPRLFSNHAAQLH
TLLGLYCVSVNCMDNAEAQFTTALRLTNHQELWAFIVTNLASVYIREGNRHQEVLYSLLE
RINPDHSFPVSSHCLRAAAFYVRGLFSFFQGRYNEAKRFLRETLKMSNAEDLNRLTACSL
VLLGHIFYVLGNHRESNNMVVPAMQLASKIPDMSVQLWSSALLRDLNKACGNAMDAHEAA
QMHQNFSQ

Cohesin_load

Cohesin_load
PFAM accession number:PF10345
Interpro abstract (IPR019440):

This entry represents the chromatid cohesion factor Mau2 and its homologues, including Scc4 from budding yeasts and Ssl3 from fission yeasts. Scc4 is a subunit of the cohesin loading factor complex (Scc2-Scc4), which is required for the loading of cohesin complexes onto chromosomes [(PUBMED:10882066)]. Ssl3 is in complex with Mis4 (Scc2 homologue) and is required in G1 for cohesin binding to chromosomes [(PUBMED:16682348)].

Animal Mau2 interacts with Nipbl (Scc2 orthologue), and both proteins are involved in sister chromatid cohesion and segregation [(PUBMED:19308700), (PUBMED:16802858), (PUBMED:16682347)].

GO process:mitotic sister chromatid cohesion (GO:0007064)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cohesin_load