The domain within your query sequence starts at position 26 and ends at position 85; the E-value for the Colipase-like domain shown below is 3.8e-19.

DKNTRVSAYKGIGEMCRNNSECQSDCCVTNSLNPQKFCTSQTVFLECVPWRKPNGFLCEE

Colipase-like

Colipase-like
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Colipase-like