The domain within your query sequence starts at position 24 and ends at position 171; the E-value for the Collectrin domain shown below is 4.6e-70.
AFKVRLSIRAALGDKAYVWDTDQEYLFRAMVAFSMRKVPNREATEISHVLLCNITQRVSF WFVVTDPSNNYTLPAAEVQSAIRKNRNRINSAFFLDDHTLEFLKIPSTLAPPMEPSVPVW IIVFGVIFCIVTVAIALLVLSGIRQRRR
Collectrin |
---|
PFAM accession number: | PF16959 |
---|---|
Interpro abstract (IPR031588): | This domain is found in collectrin, a single-pass transmembrane protein that regulates SNARE complex function [ (PUBMED:16330323) ]. This domain can be also found in the C-terminal region of human angiotensin-converting enzyme 2, ACE2 [ (PUBMED:11278314) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Collectrin