The domain within your query sequence starts at position 232 and ends at position 437; the E-value for the Complex1_49kDa domain shown below is 1.7e-105.

VHQMLTNNRIWRNRTVDIGVVTAEDALNYGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFD
VPIGSRGDCYDRYLCRVEEMRQSLRIIEQCLNKMPPGEIKVDDAKVSPPKRAEMKTSMES
LIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLDK
MSKGHMLADVVAIIGTQDIVFGEIDR

Complex1_49kDa

• PFAM accession number: PF00346
• Interpro abstract (IPR001135):

  This entry represents the subunit D (NuoD) of NADH-quinone oxidoreductase ( EC 1.6.99.5 ) and the subunit H (NdhH) of NAD(P)H-quinone oxidoreductase ([intenz:1.6.5.-]). NADH-quinone (Q) oxidoreductase is a large and complex redox proton pump, which utilises the free energy derived from oxidation of NADH with lipophilic electron/proton carrier Q to translocate protons across the membrane to generate an electrochemical proton gradient [ (PUBMED:11695831) ]. Subunit D (NuoD) is a 49kDa polypeptide that appears to be evolutionarily important in determining the physiological function of complex I/NDH-1 [ (PUBMED:11695831) ].

• GO process: oxidation-reduction process (GO:0055114)
• GO function: quinone binding (GO:0048038), NAD binding (GO:0051287), oxidoreductase activity, acting on NAD(P)H (GO:0016651)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Complex1_49kDa