The domain within your query sequence starts at position 5 and ends at position 62; the E-value for the Complex1_LYR domain shown below is 8.4e-14.

AKVLQLFKTLHRTRQQVFKNDKRALEAARVKINEEFKKHKNETSPEKIKEMMKLGSDV

Complex1_LYR

Complex1_LYR
PFAM accession number:PF05347
Interpro abstract (IPR008011):

Proteins in this family include an accessory subunit of the higher eukaryotic NADH dehydrogenase complex. In Saccharomyces cerevisiae, the Isd11 protein (Q6Q560) has been shown to play a role in Fe/S cluster biogenesis in mitochondria [(PUBMED:16341090), (PUBMED:16341089)]. We have named this family LYR after a highly conserved tripeptide motif close to the N terminus of these proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Complex1_LYR