The domain within your query sequence starts at position 598 and ends at position 709; the E-value for the Consortin_C domain shown below is 3.4e-56.

EAIPAEGLVSILKKRNDTVGSHPAQMQQKPAKRRVRFQEIDDNLEQDEVGGGSCILLILL
CIATVFLSVGGTALYCTLGNIESPVCTDFADNVDFYYTKLLQGVAGLKHWVY

Consortin_C

Consortin_C
PFAM accession number:PF15281
Interpro abstract (IPR028129):

Consortin is a trans-Golgi network cargo receptor involved in targeting connexins to the plasma membrane [(PUBMED:19864490)]. This entry represents the C-terminal domain of consortin.

GO process:positive regulation of Golgi to plasma membrane protein transport (GO:0042998)
GO component:trans-Golgi network (GO:0005802)
GO function:connexin binding (GO:0071253)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Consortin_C