The domain within your query sequence starts at position 140 and ends at position 442; the E-value for the Coprogen_oxidas domain shown below is 7.6e-142.

KMELMIMETQAQVCRALAQVDGVADFTVDRWERKEGGGGITCVLQDGRVFEKAGVSISVV
HGNLSEEAANQMRGRGKTLKTKDSKLPFTAMGVSSVIHPKNPYAPTMHFNYRYFEVEEAD
GNTHWWFGGGCDLTPTYLNQEDAVHFHRTLKEACDQHGPDIYPKFKKWCDDYFFIVHRGE
RRGIGGIFFDDLDSPSKEEAFRFVKTCAEAVVPSYVPIVKKHCDDSYTPRDKLWQQLRRG
RYVEFNLLYDRGTKFGLFTPGSRIESILMSLPLTARWEYMHSPPENSKEAEILEVLRHPK
DWV

Coprogen_oxidas

Coprogen_oxidas
PFAM accession number:PF01218
Interpro abstract (IPR001260):

Coprogen oxidase (i.e. coproporphyrin III oxidase or coproporphyrinogenase) catalyses the oxidative decarboxylation of coproporphyrinogen III to proto-porhyrinogen IX in the haem and chlorophyll biosynthetic pathways [(PUBMED:8407975), (PUBMED:8219054)]. The protein is a homodimer containing two internally bound iron atoms per molecule of native protein [(PUBMED:3516695)]. The enzyme is active in the presence of molecular oxygen that acts as an electron acceptor. The enzyme is widely distributed having been found in a variety of eukaryotic and prokaryotic sources.

GO process:porphyrin-containing compound biosynthetic process (GO:0006779), oxidation-reduction process (GO:0055114)
GO function:coproporphyrinogen oxidase activity (GO:0004109)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Coprogen_oxidas