The domain within your query sequence starts at position 140 and ends at position 442; the E-value for the Coprogen_oxidas domain shown below is 7.6e-142.
KMELMIMETQAQVCRALAQVDGVADFTVDRWERKEGGGGITCVLQDGRVFEKAGVSISVV HGNLSEEAANQMRGRGKTLKTKDSKLPFTAMGVSSVIHPKNPYAPTMHFNYRYFEVEEAD GNTHWWFGGGCDLTPTYLNQEDAVHFHRTLKEACDQHGPDIYPKFKKWCDDYFFIVHRGE RRGIGGIFFDDLDSPSKEEAFRFVKTCAEAVVPSYVPIVKKHCDDSYTPRDKLWQQLRRG RYVEFNLLYDRGTKFGLFTPGSRIESILMSLPLTARWEYMHSPPENSKEAEILEVLRHPK DWV
Coprogen_oxidas |
---|
PFAM accession number: | PF01218 |
---|---|
Interpro abstract (IPR001260): | Coprogen oxidase (i.e. coproporphyrin III oxidase or coproporphyrinogenase) catalyses the oxidative decarboxylation of coproporphyrinogen III to proto-porhyrinogen IX in the haem and chlorophyll biosynthetic pathways [ (PUBMED:8407975) (PUBMED:8219054) ]. The protein is a homodimer containing two internally bound iron atoms per molecule of native protein [ (PUBMED:3516695) ]. The enzyme is active in the presence of molecular oxygen that acts as an electron acceptor. The enzyme is widely distributed having been found in a variety of eukaryotic and prokaryotic sources. |
GO process: | oxidation-reduction process (GO:0055114), porphyrin-containing compound biosynthetic process (GO:0006779) |
GO function: | coproporphyrinogen oxidase activity (GO:0004109) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Coprogen_oxidas