The domain within your query sequence starts at position 39 and ends at position 135; the E-value for the Coq4 domain shown below is 2e-33.

YPDHIPTTPLQKMLLAAGAAGMALYNPYRHDMVAVLGETTGCHTLKFLRDQMKKDPEGAQ
ILQERPRISLSTLDLSKLQSLPEGSLGQGLSRHTSTY

Coq4

Coq4
PFAM accession number:PF05019
Interpro abstract (IPR007715):

Coq4 is a component of a multi-subunit COQ enzyme complex, which plays a role in the coenzyme Q (ubiquinone) biosynthetic pathway [ (PUBMED:11469793) (PUBMED:15792955) (PUBMED:17391640) ]. In budding yeasts, Coq4 plays an essential role in organising the COQ enzyme complex and is required for steady-state levels of Coq3, Coq6, Coq7 and Coq9 [ (PUBMED:19022396) ].

GO process:ubiquinone biosynthetic process (GO:0006744)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Coq4