The domain within your query sequence starts at position 32 and ends at position 138; the E-value for the CortBP2 domain shown below is 3.1e-34.

DVDTLSKSELRMLLSVMEGELEARDLVIEALRARRKEVFIQERYGRFNLNDPFLALQRDY
EAGPGDKEKPVCTNPLSILEAVMAHCRKMQERMSAQLVAAESRQKKL

CortBP2

CortBP2
PFAM accession number:PF09727
Interpro abstract (IPR019131):

This entry represents a N-terminal domain found in cortactin-binding protein 2 and in filamin A interacting protein 1 (Filip1).

In addition to being a positional candidate for autism, cortactin-binding protein 2 is expressed at highest levels in the brain in humans. Towards the C-terminal end of this protein are a series of proline-rich regions which are likely to be the points of interaction with the SH3 domain of cortactin. The human protein has six associated ankyrin repeat domains (IPR002110) towards the C terminus of the protein which act as protein-protein interaction domains [(PUBMED:11707066)].

Filip1 controls the start of neocortical cell migration from the ventricular zone by acting through a filamin-A/F-actin axis. It may be able to induce the degradation of Filamin A [(PUBMED:12055638), (PUBMED:15794127)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CortBP2