The domain within your query sequence starts at position 168 and ends at position 452; the E-value for the Cse1 domain shown below is 2.8e-12.
SPLVAAMQHFLPVLKDRFIQLLSDQSDQSVLIQKQIFKIFYALVQYTLPLELINQQNLTE WVEILKTVVNRDVPNETLQVEEDDRPELPWWKCKKWALHILARLFERYGSPGNVSKEYNE FAEVFLKAFAVGVQQVLLKVLYQYKEKQYMAPRVLQQTLNYINQGVSHALTWKNLKPHIQ GIIQDVIFPLMCYTDADEELWQEDPYEYIRMKFDVFEDFISPTTAAQTLLFTACSKRKEV LQKTMGFCYQILTEPNADPRKKDGALHMIGSLAEILLKKKIYKDQ
Cse1 |
---|
PFAM accession number: | PF08506 |
---|---|
Interpro abstract (IPR013713): | This domain is found in exportin-2 and related proteins, such as exportin-7/8. This domain contains HEAT repeats. Exportin-2, also known as CAS, is an export receptor for importin-alpha [ (PUBMED:9323134) ]. It binds strongly to importin alpha only in the presence of RanGTP, forming an importin alpha/CAS/RanGTP complex. Exportin-2 mediates importin-alpha re-export from the nucleus to the cytoplasm after import substrates have been released into the nucleoplasm [ (PUBMED:10394916) ]. |
GO process: | intracellular protein transport (GO:0006886) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cse1