The domain within your query sequence starts at position 168 and ends at position 452; the E-value for the Cse1 domain shown below is 2.8e-12.

SPLVAAMQHFLPVLKDRFIQLLSDQSDQSVLIQKQIFKIFYALVQYTLPLELINQQNLTE
WVEILKTVVNRDVPNETLQVEEDDRPELPWWKCKKWALHILARLFERYGSPGNVSKEYNE
FAEVFLKAFAVGVQQVLLKVLYQYKEKQYMAPRVLQQTLNYINQGVSHALTWKNLKPHIQ
GIIQDVIFPLMCYTDADEELWQEDPYEYIRMKFDVFEDFISPTTAAQTLLFTACSKRKEV
LQKTMGFCYQILTEPNADPRKKDGALHMIGSLAEILLKKKIYKDQ

Cse1

Cse1
PFAM accession number:PF08506
Interpro abstract (IPR013713):

The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane. Active transport of large molecules through these pore complexes require carrier proteins, called karyopherins (importins and exportins), which shuttle between the two compartments.

This domain is found in exportin Cse1 (also known as importin-alpha re-exporter). Exportin Cse1 mediates nuclear transport of importin-alpha back into the cytosol, where importin-alpha functions as a transporter of proteins carrying nuclear localisation signals (NLS) from the cytoplasm into the nucleus [(PUBMED:15602554), (PUBMED:15866177), (PUBMED:17170104)]. This domain contains HEAT repeats.

GO process:intracellular protein transport (GO:0006886)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cse1