The domain within your query sequence starts at position 4 and ends at position 123; the E-value for the CtIP_N domain shown below is 5.6e-56.
FMESLNRLKEAHEKEVLGLQNKLLELNSERCRDAQRVEELFAKNHQLREQQKALKENLRV LENRLRAGLCDRCMVTQELARKKQLELENAHLQSLQHLCILTNEMNGLREENKILKEEVK
CtIP_N |
![]() |
---|
PFAM accession number: | PF10482 |
---|---|
Interpro abstract (IPR019518): | CtIP is predominantly a nuclear protein that complexes with both BRCA1 and the BRCA1-associated RING domain protein (BARD1). At the protein level, CtIP expression varies with cell cycle progression in a pattern identical to that of BRCA1. Thus, the steady-state levels of CtIP polypeptides, which remain low in resting cells and G1 cycling cells, increase dramatically as Dividing cells traverse the G1/S boundary. CtIP can potentially modulate the functions ascribed to BRCA1 in transcriptional regulation, DNA repair, and/or cell cycle checkpoint control [(PUBMED:18007598)]. This N-terminal domain carries a coiled-coil region and is essential for homodimerisation of the protein [(PUBMED:17936710)]. The C-terminal domain is family CtIP_C and carries functionally important CxxC and RHR motifs, absence of which lead cells to grow slowly and show hypersensitivity to genotoxins [(PUBMED:17936710)]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CtIP_N