The domain within your query sequence starts at position 4 and ends at position 123; the E-value for the CtIP_N domain shown below is 5.6e-56.

FMESLNRLKEAHEKEVLGLQNKLLELNSERCRDAQRVEELFAKNHQLREQQKALKENLRV
LENRLRAGLCDRCMVTQELARKKQLELENAHLQSLQHLCILTNEMNGLREENKILKEEVK

CtIP_N

CtIP_N
PFAM accession number:PF10482
Interpro abstract (IPR019518):

CtIP is predominantly a nuclear protein that complexes with both BRCA1 and the BRCA1-associated RING domain protein (BARD1). At the protein level, CtIP expression varies with cell cycle progression in a pattern identical to that of BRCA1. Thus, the steady-state levels of CtIP polypeptides, which remain low in resting cells and G1 cycling cells, increase dramatically as Dividing cells traverse the G1/S boundary. CtIP can potentially modulate the functions ascribed to BRCA1 in transcriptional regulation, DNA repair, and/or cell cycle checkpoint control [ (PUBMED:18007598) ]. This N-terminal domain carries a coiled-coil region and is essential for homodimerisation of the protein [ (PUBMED:17936710) ]. The C-terminal domain is family CtIP_C and carries functionally important CxxC and RHR motifs, absence of which lead cells to grow slowly and show hypersensitivity to genotoxins [ (PUBMED:17936710) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CtIP_N