The domain within your query sequence starts at position 1 and ends at position 94; the E-value for the Ctf8 domain shown below is 8e-24.

MELQGEIEARYSTGLAGNLLGDLHYTTEGIPVLIVGHHILYGKTIHLEKPFAVLVKHTPG
KQDCDEPGRGTGTQYLVTALIKNKILFKTRPKPI

Ctf8

Ctf8
PFAM accession number:PF09696
Interpro abstract (IPR018607):

Ctf8 is a component of the RFC-like complex CTF18-RFC which is required for efficient establishment of chromosome cohesion during S-phase and may load or unload POL30/PCNA. During a clamp loading circle, the RFC:clamp complex binds to DNA and the recognition of the double-stranded/single-stranded junction stimulates ATP hydrolysis by RFC [(PUBMED:11389843), (PUBMED:15964801)].

GO process:mitotic sister chromatid cohesion (GO:0007064)
GO component:Ctf18 RFC-like complex (GO:0031390)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ctf8