The domain within your query sequence starts at position 198 and ends at position 349; the E-value for the Cu2_monoox_C domain shown below is 1.2e-54.

PLIAGMYLMMSVNTVIPPGEKVVNSDISCHYKMYPMHVFAYRVHTHHLGKVVSGYRVRNG
QWTLIGRQSPQLPQAFYPVEHPVDVAFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLY
IMYYMEAKHAVSFMTCTQNVAPDMFRTIPEEA

Cu2_monoox_C

Cu2_monoox_C
PFAM accession number:PF03712
Interpro abstract (IPR024548):

Copper type II, ascorbate-dependent monooxygenases [(PUBMED:2792366)] are a class of enzymes that requires copper as a cofactor and which uses ascorbate as an electron donor. This family contains two related enzymes, dopamine-beta-monooxygenase (EC 1.14.17.1) and peptidyl-glycine alpha-amidating monooxygenase (EC 1.14.17.3). There are a few regions of sequence similarities between these two enzymes, two of these regions contain clusters of conserved histidine residues which are most probably involved in binding copper.

This entry represents the C-terminal domain of the enzyme which, like the N terminus has a PNGase F-like fold.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cu2_monoox_C