The domain within your query sequence starts at position 159 and ends at position 278; the E-value for the Cullin_binding domain shown below is 1.8e-38.

IDGICARFPSLLTEAKQEDKFKDLYRFTFQFGLDSEEGQRSLHREIAIALWKLVFTQNNP
PVLDQWLNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFVEWEM

Cullin_binding

Cullin_binding
PFAM accession number:PF03556
Interpro abstract (IPR005176):

This domain is found in the eukaryotic family defective in cullin neddylation, which includes DCN1 and DCN1-like proteins. Proteins of the DCN family may contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes, which are multi-protein complexes required for polyubiquitination and subsequent degradation of target proteins by the 26S proteasome [(PUBMED:15988528), (PUBMED:18826954)].

The structure of this domain is composed entirely of alpha helices [(PUBMED:17597076), (PUBMED:18206966)]. It has been referred to as potentiating neddylation domain (PONY) and can be found in association with an N-terminal UBA domain. The PONY domain contains a cullin-binding surface within its C-terminal region and is sufficient to promote neddylation [(PUBMED:18206966)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cullin_binding