The domain within your query sequence starts at position 63 and ends at position 133; the E-value for the Cupin_2 domain shown below is 3.7e-11.
IKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEKGDMITLPAGIYHRFTLDEK NYVKAMRLFVG
Cupin_2 |
---|
PFAM accession number: | PF07883 |
---|---|
Interpro abstract (IPR013096): | This family represents the conserved barrel domain of the cupin superfamily [ (PUBMED:9573603) ] (cupa is the Latin term for a small barrel). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cupin_2