The domain within your query sequence starts at position 2 and ends at position 62; the E-value for the Cupin_8 domain shown below is 2.8e-27.

IPLDPLAPDLTQYPSYSQAQALHCTVRAGEMLYLPALWFHHVQQSHGCIAVNFWYDMEYD
L

Cupin_8

Cupin_8
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cupin_8