The domain within your query sequence starts at position 25 and ends at position 226; the E-value for the CutC domain shown below is 7.8e-81.
FLMEVCVDSVESAVNAERGGAGRIELCSGLLEGGTTPSMGVLQVVKQSVQIPVFVMIRPR GGDFLYSDREVEVMKADIRLAKLYGADGLVFGALTEDGHIDKELCLSLVALCRPLPVTFH RAFDMVHDPMAALETLLTLGFERVLTSGCDSSALEGLPLIKQLIDQAKGRIVVMPGGGIT DKNLQRILEGSGATEFHCSARS
CutC |
---|
PFAM accession number: | PF03932 |
---|---|
Interpro abstract (IPR023648): | CutC is a protein involved in copper homeostasis [ (PUBMED:7635807) ]. Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF. A mutation in one or more of these genes results in an increased copper sensitivity. The CutC monomer structure adopts a common TIM beta/alpha barrel with 8 beta strands surrounded by 8 alpha helices [ (PUBMED:15624211) ]. |
GO process: | copper ion homeostasis (GO:0055070) |
GO function: | copper ion binding (GO:0005507) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CutC