The domain within your query sequence starts at position 655 and ends at position 779; the E-value for the CwfJ_C_1 domain shown below is 1.8e-40.
IAEHQSLAAKMAKCLYCFDSSQFPKHLIVAIGVKVYLCLPSFQSLTEGHCFIVPLQHHQA ATVLDEDVWEEIQMFRKSLVKMFEDKELDCIFLETNMGLKKHYHMVYECIPLPKEVGDMA PIYFK
CwfJ_C_1 |
 |
|---|
| PFAM accession number: | PF04677 |
|---|---|
| Interpro abstract (IPR006768): | This group of sequences contain a conserved C-terminal domain which is found in the Schizosaccharomyces pombe (Fission yeast) protein Cwf19 ( Q09909 ) and its homologues. Cwf19 is part of the Cdc5p complex involved in mRNA splicing [ (PUBMED:11884590) ]. This domain is found in association with IPR006767 which is generally C-terminal and adjacent to this domain. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CwfJ_C_1