The domain within your query sequence starts at position 655 and ends at position 779; the E-value for the CwfJ_C_1 domain shown below is 1.8e-40.

IAEHQSLAAKMAKCLYCFDSSQFPKHLIVAIGVKVYLCLPSFQSLTEGHCFIVPLQHHQA
ATVLDEDVWEEIQMFRKSLVKMFEDKELDCIFLETNMGLKKHYHMVYECIPLPKEVGDMA
PIYFK

CwfJ_C_1

CwfJ_C_1
PFAM accession number:PF04677
Interpro abstract (IPR006768):

This group of sequences contain a conserved C-terminal domain which is found in the Schizosaccharomyces pombe (Fission yeast) protein Cwf19 (Q09909) and its homologues. Cwf19 is part of the Cdc5p complex involved in mRNA splicing [(PUBMED:11884590)]. This domain is found in association with IPR006767, which is generally C-terminal and adjacent to this domain.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CwfJ_C_1