The domain within your query sequence starts at position 788 and ends at position 882; the E-value for the CwfJ_C_2 domain shown below is 4.6e-34.

EWSMNKKLIDLSSKDIRKSVPRGLPYFAVDFGLQGGFAHIIEDQYRFPHYFGKEIIGGML
DLEPRLWRKGIRESFEDQRKKSLQFAQWWKPYDIT

CwfJ_C_2

CwfJ_C_2
PFAM accession number:PF04676
Interpro abstract (IPR006767):

This group of sequences contain a conserved C-terminal domain which is found in the Schizosaccharomyces pombe (Fission yeast) protein Cwf19 (Q09909) and its homologues. Cwf19 is part of the Cdc5p complex involved in mRNA splicing [(PUBMED:11884590)]. This domain is found in association with IPR006768, which is generally N-terminal and adjacent to this domain.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CwfJ_C_2