The domain within your query sequence starts at position 1 and ends at position 229; the E-value for the Cwf_Cwc_15 domain shown below is 1.5e-79.
MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFR RELEERERAAARDKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEE SDDDDTAALLAELEKIKKERAEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPSQPQA NFKVKRRWDDDVVFKNCAKGIDDQKKDKRFVNDTLRSEFHKKFMEKYIK
Cwf_Cwc_15 |
---|
PFAM accession number: | PF04889 |
---|---|
Interpro abstract (IPR006973): | This family represents Cwf15/Cwc15 (from Schizosaccharomyces pombe and Saccharomyces cerevisiae respectively) and their homologues. It is a component of a complex containing Cef1 and may be involved in pre-mRNA splicing [ (PUBMED:11884590) ]. |
GO process: | mRNA splicing, via spliceosome (GO:0000398) |
GO component: | spliceosomal complex (GO:0005681) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cwf_Cwc_15