The domain within your query sequence starts at position 7 and ends at position 115; the E-value for the Cylicin_N domain shown below is 1.1e-43.

LKVTYGAYDNYIPVSELSKKSWNQQYFSLAFPKPPRPGKKRRSLPSQLQNNTAPVIDEEK
LGVHRPPLWMHRSLMRISERPSVYLAARKGLIPKPLHFGKGESKSVGTH

Cylicin_N

Cylicin_N
PFAM accession number:PF15241
Interpro abstract (IPR029354):

This entry represents the N-terminal of cylicin proteins. Cylicins are proteins of the sperm head cytoskeleton and may play a role in spermatid differentiation [(PUBMED:7737358)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cylicin_N