The domain within your query sequence starts at position 283 and ends at position 423; the E-value for the Cys_Met_Meta_PP domain shown below is 1.5e-6.

RNISGTSKFHVELEQALADLHGKDAALLFSSCFVANDSTLFTLAKMMPGCEIYSDSGNHA
SMIQGIRNSRVPKYIFRHNDVNHLRELLQRSDPSVPKIVAFETVHSMDGAVCPLEELCDV
AHEFGAITFVDEVHAVGLYGA

Cys_Met_Meta_PP

 Cys_Met_Meta_PP
PFAM accession number:PF01053
Interpro abstract (IPR000277):

Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal). Pyridoxal 5'-phosphate (PLP) is a versatile catalyst, acting as a coenzyme in a multitude of reactions, including decarboxylation, deamination and transamination [ (PUBMED:8690703) (PUBMED:7748903) (PUBMED:15189147) ]. PLP-dependent enzymes are primarily involved in the biosynthesis of amino acids and amino acid-derived metabolites, but they are also found in the biosynthetic pathways of amino sugars and in the synthesis or catabolism of neurotransmitters; pyridoxal phosphate can also inhibit DNA polymerases and several steroid receptors [ (PUBMED:17109392) ]. Inadequate levels of pyridoxal phosphate in the brain can cause neurological dysfunction, particularly epilepsy [ (PUBMED:16763894) ].

PLP enzymes exist in their resting state as a Schiff base, the aldehyde group of PLP forming a linkage with the epsilon-amino group of an active site lysine residue on the enzyme. The alpha-amino group of the substrate displaces the lysine epsilon-amino group, in the process forming a new aldimine with the substrate. This aldimine is the common central intermediate for all PLP-catalysed reactions, enzymatic and non-enzymatic [ (PUBMED:15581583) ].

A number of pyridoxal-dependent enzymes involved in the metabolism of cysteine, homocysteine and methionine have been shown [ (PUBMED:1577698) (PUBMED:8511966) ] to be evolutionary related. These enzymes are proteins of about 400 amino-acid residues. The pyridoxal-P group is attached to a lysine residue located in the central section of these enzymes.

One of these enzymes is the sulfhydrylase FUB7 from fungi such as Gibberella and Fusarium. The gene is part of a cluster that mediates the biosynthesis of fusaric acid, a mycotoxin with low to moderate toxicity to animals and humans, but with high phytotoxic properties [ (PUBMED:26662839) ].

GO process:transsulfuration (GO:0019346)
GO function:pyridoxal phosphate binding (GO:0030170)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cys_Met_Meta_PP