The domain within your query sequence starts at position 1 and ends at position 266; the E-value for the Cyto_heme_lyase domain shown below is 4.8e-93.
MGASASSPATAVNASNASDGQPASPPSGCPMHKGQRKGCPVTAATSDLTSESKAHTVPAH QDRAYDYVECPVTGARAKDKESLDPSNLMPPPNQTPSPDQPFTLSTSREESSIPRADSEK KWVYPSEQMFWNAMLRKGWKWKDDDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAHEC PCGPSLVRFGGKAREYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNK EYQFTILDVRPAFDSFSAVWDRMKVA
Cyto_heme_lyase |
---|
PFAM accession number: | PF01265 |
---|---|
Interpro abstract (IPR000511): | Cytochrome c haem-lyase (CCHL) ( EC 4.4.1.17 ) and cytochrome Cc1 haem-lyase (CC1HL) [ (PUBMED:1499554) ] are mitochondrial enzymes that catalyse the covalent attachment of a haem group on two cysteine residues of cytochrome c and c1. These two enzymes are functionally and evolutionary related. There are two conserved regions, the first is located in the central section and the second in the C-terminal section. Both patterns contain conserved histidine, tryptophan and acidic residues which could be important for the interaction of the enzymes with the apoproteins and/or the haem group. |
GO component: | mitochondrion (GO:0005739) |
GO function: | holocytochrome-c synthase activity (GO:0004408) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cyto_heme_lyase