The domain within your query sequence starts at position 67 and ends at position 139; the E-value for the CytochromB561_N domain shown below is 1.4e-8.
VVQTTPPRDLAATQISPSPPSPSIQGQSVLSYSPSRSPSTSPKFATSCMTGYSPQLQGLS SGGLGSYSPGVTY
CytochromB561_N |
---|
PFAM accession number: | PF09786 |
---|---|
Interpro abstract (IPR019176): | Members of this family include cytochrome B561, as well as various other putative, uncharacterised proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CytochromB561_N