The domain within your query sequence starts at position 2 and ends at position 190; the E-value for the Cytochrom_B558a domain shown below is 7.8e-110.

GQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIAAGVLICLLEYPRGKRKK
GSTMERCGQKYLTSVVKLFGPLTRNYYVRAALHFLLSVPAGFLLATILGTVCLAIASVIY
LLAAIRGEQWTPIEPKPKERPQVGGTIKQPPTNPPPRPPAEVRKKPSEGEEEAASAGGPQ
VNPMPVTDE

Cytochrom_B558a

 Cytochrom_B558a
PFAM accession number:PF05038
Interpro abstract (IPR007732):

Flavocytochrome b558 is the catalytic core of the respiratory-burst oxidase, an enzyme complex that catalyzes the NADPH-dependent reduction of O2 into the superoxide anion O2 in phagocytic cells. Flavocytochrome b558 is anchored in the plasma membrane. It is a heterodimer that consists of a large glycoprotein gp91phox (phox forphagocyte oxidase) (beta subunit) and a small protein p22phox (alpha subunit). The other components of the respiratory-burst oxidase are water-soluble proteins of cytosolic origin, namely p67phox, p47phox, p40phox and Rac. Upon cell stimulation, they assemble with the membrane-bound flavocytochrome b558 which becomes activated and generates O2- [ (PUBMED:8798532) ].

GO function:heme binding (GO:0020037)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cytochrom_B558a