The domain within your query sequence starts at position 14 and ends at position 314; the E-value for the D123 domain shown below is 3e-107.

WYPLFRSLTIKSVILPLPQNVKDYLLDDGTLVVSGREDPPTCSQSDSGNEAEETQWSDDE
STATLTAPEFPEFNTQVQEAINSLGGSVFPKLNWSAPRDAYWIAMNSSLKCKTLSDIFLL
FKSSDFITHDFTQPFIHCTDDSPDPCIEYELVLRKWCELIPGAEFRCFVKENKLIGISQR
DYTQYYDHISKQKEEICRCIQDFFKEHLQYKFLDEDFVFDIYRDSRGKVWLIDFNPFGEV
TDSLLFTWEELTSENNLRGEVTEGDAQEQDSPAFRCTNSEVTVQPSPYLSFGLPKDFVDL
S

D123

D123
PFAM accession number:PF07065
Interpro abstract (IPR009772):

This family contains a number of eukaryotic cell division cycle 123 (Cdc123, also known as D123) proteins approximately 330 residues long. It has been shown that mutated variants of Cdc123 exhibit temperature-dependent differences in their degradation rate [(PUBMED:11699637)]. Budding yeast Cdc123 regulates the cell cycle in a nutrient dependent manner [(PUBMED:15319434)].

GO process:cell cycle (GO:0007049)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry D123