The domain within your query sequence starts at position 1 and ends at position 113; the E-value for the DAD domain shown below is 8e-55.

MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGF
ISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG

DAD

 DAD
PFAM accession number:PF02109
Interpro abstract (IPR003038):

Members of this family are thought to be integral membrane proteins. Some members of this family have been shown to cause apoptosis if mutated [ (PUBMED:8413235) ], these proteins are known as DAD for defender against death. The family also includes the epsilon subunit of the oligosaccharyltransferase that is involved in N-linked glycosylation (also known as Ost2) [ (PUBMED:7593165) ].

DAD1/Ost2 is a component of the N-oligosaccharyl transferase enzyme which catalyses the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains [ (PUBMED:9167970) ].

GO component:integral component of membrane (GO:0016021), oligosaccharyltransferase complex (GO:0008250)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DAD